SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000009108 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000009108
Domain Number 1 Region: 51-140
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 5.95e-36
Family SCAN domain 0.0000457
Further Details:      
 
Domain Number 2 Region: 386-441
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.35e-22
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 3 Region: 483-535
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.55e-20
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 4 Region: 445-498
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.88e-20
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 5 Region: 142-185
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000183
Family KRAB domain (Kruppel-associated box) 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000009108   Gene: ENSPVAG00000009663   Transcript: ENSPVAT00000009662
Sequence length 536
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_2535:6911:15234:-1 gene:ENSPVAG00000009663 transcript:ENSPVAT00000009662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSILTASLGSDAEAGAKVAAPPLRDGLLIVKVEEDSFGGLESDLPGDCQDSETCRLHFR
RFRYQEVASPEEALSRLRELCRRWLRPEMHSKEQILELLVLEQFLAILPPELQAWVRKHC
PQSGKEAGAVVRTLQRALGELSPQGLVNVKDVAVSLTWEEWEHLDPVQRVFYRESKPKDY
GNIAPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXECGKSFSQSAALVKHQRTHTGEKPYTCPKCGDSFRQSSH
LNRHQKIHIGEKHYKCNECGETCRISNRFRHQRIHKGERPYTCEECEKSFKRCSDLCKHQ
RIHTGEKPYGCSVCGKRFSQSATLITHQRTHTGEKPYKCLECGESFRQSPHLIRHQ
Download sequence
Identical sequences ENSPVAP00000009108 ENSPVAP00000009108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]