SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000009111 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000009111
Domain Number 1 Region: 43-129
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 4.07e-28
Family SCAN domain 0.00014
Further Details:      
 
Domain Number 2 Region: 352-408
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.85e-24
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 577-634
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.52e-22
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 4 Region: 528-578
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.74e-20
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 763-815
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.6e-17
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 6 Region: 397-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.29e-16
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 7 Region: 690-743
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000005
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 8 Region: 217-268
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000000392
Family KRAB domain (Kruppel-associated box) 0.0022
Further Details:      
 
Domain Number 9 Region: 634-689
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000212
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000009111   Gene: ENSPVAG00000009665   Transcript: ENSPVAT00000009665
Sequence length 829
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_2535:24583:45063:1 gene:ENSPVAG00000009665 transcript:ENSPVAT00000009665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIMTESGEVTDLDPPTETSQEQEDLLIVKVEEEDCTWMQEYNPPVFETFYQRFKHFQYHE
ASGPREALSQLRVLCCEWLRPELHTKEQILELLVLEQFLTILPEFQTVRHHPDGEEAVAV
VENIQKELEERRQQIVACPEVLSQKMVPPGAVQESFSHQLLSLNPQPEQEPQKPHLLEEN
ALPALQVSSLPLKDSQELTASLLSAGSQKLVKIEDVADVAVSFILEEWGHLDQSQKALYR
DDRKENYESITSMDYESRNDNMELIVKQISDEAESHWMTSGSTERNVPQSQEFGEVSDLH
GMVDRWQVNPTVGKSRQNPSQKRDLGAITDINRKQKTNAERGHKCNDCGKFFLQASNFIQ
HRRIHTGEKPFKCGECGKSYNQRVHLTQHQRVHTGEKPYKCQVCGKAFRVSSHLVQHHSV
HSGERPYGCTECGKNFGRHSHLIEHLKRHFREKSQRCSDKRSKNTKLNVKKKISEFSEAD
MELSGRIQRSVSQVQDFGEGKLDRKQCIPMKEILGQPSSKRRNFSEVTYVHKKSSTGERP
HKCNECGKSFIQSAHLIQHQRIHTGEKPFKCDECGKSYNQRVHLTQHQRVHTGEKPYTCH
LCGKAFRVRSHLVHHQSVHSGERPFKCNECGKGFGRRSHLAGHLRLHSREKSHQCHECGE
IFFQYVSLIEHQVLHMGQKNEKNGICEEAYSWNLTVIEDKKFELQEQPYKCDICGKAFSY
SSDLIQHYRTHTAEKTYKCDICRENVGQCSHIKQHQKSYSNMKSHQCNECGRGFTLKSHL
NQHQRIHTGEKPFQCKECGMSFSWSCSLFKHLRSHDRTDFINTSVVFPL
Download sequence
Identical sequences ENSPVAP00000009111 ENSPVAP00000009111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]