SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000009393 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000009393
Domain Number 1 Region: 132-215
Classification Level Classification E-value
Superfamily Snake toxin-like 0.00000000000744
Family Extracellular domain of cell surface receptors 0.044
Further Details:      
 
Weak hits

Sequence:  ENSPVAP00000009393
Domain Number - Region: 18-110
Classification Level Classification E-value
Superfamily Snake toxin-like 0.000388
Family Extracellular domain of cell surface receptors 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000009393   Gene: ENSPVAG00000009967   Transcript: ENSPVAT00000009965
Sequence length 251
Comment pep:known_by_projection scaffold:pteVam1:scaffold_10368:24077:27318:1 gene:ENSPVAG00000009967 transcript:ENSPVAT00000009965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMGVPRAILLYLCGAALYPTVSQALQCYSFQHIYYGPFDLSNMKFLNISCPQGCSESVL
SLDTGYRASVTMVQKGCWTGPPEGQMQSNDMALPPDYSVMRGCGTDLCNAQLMTHDAIPN
LSAAPDPQTLSGTECYACVGTRPEDCTPEKSRRVQCHQDQSVCFQGNGQMTVGNFSVPVY
IRTCHRPSCTIMGTTSPWTDIDLEGSCCSGHLCNRDAVNQTFTSASATSPPQAPLVMVLL
LVLPLLWLSAE
Download sequence
Identical sequences ENSPVAP00000009393 ENSPVAP00000009393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]