SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000009476 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000009476
Domain Number 1 Region: 303-360
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 69-129
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.89e-23
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 3 Region: 359-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-21
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 4 Region: 415-472
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.11e-21
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 5 Region: 265-317
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.63e-19
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 6 Region: 457-509
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.72e-18
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Weak hits

Sequence:  ENSPVAP00000009476
Domain Number - Region: 2-38
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.00137
Family SCAN domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000009476   Gene: ENSPVAG00000010052   Transcript: ENSPVAT00000010051
Sequence length 522
Comment pep:known_by_projection scaffold:pteVam1:scaffold_6194:13465:22897:-1 gene:ENSPVAG00000010052 transcript:ENSPVAT00000010051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQQLLITLPTQASTWVKLHHPKKAQEGALLWEDVTKLFEGEALLSQDADETQRELKDEV
TSRASTAXXXERLTFKDISVNFTQEEWGQLTPAHQNLYREVMLENYGNLVSVGYQISKPR
VISQLEKGEDPWITEKEGPGHPSSDLKSKTETSMSTAKNAILQKQLYHGIMMERFVRDDV
ICSTLEKVSKYDDELERHRDAHGRVVRQTILTHKKRGQETNKFGENIVSSNVILEQRHRK
YDTLRKRKKYKLDLINHPTSYIRTKTYECNICEKIFKQPIHLTEHMRIHTGEKPFRCKEC
GRAFSQSASLNTHQRIHTGEKPFECEECGKAFRHRSSLNQHHRTHTGEKPYVCDKCQKAF
SQNISLIQHLRTHSGEKPFTCNECGKTFRQIRHLSEHVRIHTGEKPYACTACCKTFSHRA
YLTHHQRIHTGERPYKCKECGKAFRQRIHLSNHKTVHTGVKAYECNRCGKAYRHDSSFKK
HQRHHTGEKPYECNECGKAFSYNSSLTRHHEIHRRNAFRNNM
Download sequence
Identical sequences ENSPVAP00000009476 ENSPVAP00000009476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]