SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000009589 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000009589
Domain Number 1 Region: 166-359
Classification Level Classification E-value
Superfamily vWA-like 1.28e-51
Family Integrin A (or I) domain 0.0000000193
Further Details:      
 
Domain Number 2 Region: 29-147,338-618
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.06e-43
Family Integrin alpha N-terminal domain 0.00071
Further Details:      
 
Domain Number 3 Region: 621-764
Classification Level Classification E-value
Superfamily Integrin domains 9.42e-33
Family Integrin domains 0.00081
Further Details:      
 
Domain Number 4 Region: 767-892
Classification Level Classification E-value
Superfamily Integrin domains 1.15e-22
Family Integrin domains 0.0083
Further Details:      
 
Domain Number 5 Region: 900-1100
Classification Level Classification E-value
Superfamily Integrin domains 1.46e-19
Family Integrin domains 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000009589   Gene: ENSPVAG00000010168   Transcript: ENSPVAT00000010169
Sequence length 1134
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_2275:99985:239988:1 gene:ENSPVAG00000010168 transcript:ENSPVAT00000010169 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPLCPANPGVAVACCWLLTVVLGFCASFNVDVKNSMTFSGPVEDMFGYTVQQYENEEGK
WVLIGSPLVGQPKNRTGDVYKCPVGRGESLPCIKLDLPXXXSIPNVTEVKEMTFGSTLVT
NPNGGFLACGPLYAYRCGHLHYTTGICSDVSPTFQVVNSIAPVQECSTQLDIVIVLDGSN
SIYPWESVTAFLNNLLERMDIGPKQTQVGIVQYGENVTHEFNLNTYSSTEEVLVAANKIG
QRGGRQTMTALGIDTARKEAFTEARGARRGIKKVMVIVTDGESHDNHRLNKVIQDCEDEN
IQRFSIAILGSYNRGNLSTEKFVEEIKSIASEPTEKHFFNVSDELALVTIVEALGERIFA
LEATADQSAASFEMEMSQTGFSAHYSRDWVMLGAVAYDWNGTVVMQANQIIIPQNTTFNV
KSTKKNEPLASYLGYTVNSATIPGDVLYIAGQPRYNHTGQVVIYRMEDGDIRILQTLCGE
QIVYFGGVTTVDTRFEYQMSLEPIKQTCCSSLKHNSCTKENKNEPCGARFGTAIAAVKDL
NLDGFNDIVIAPEDDHGGAVYIYHSKTIEKGMARIPSGGDGETLKFFGQSIHGEMDLNGD
GLTDVTIGGLGGAALFWSRDVAVVKVTMNFEPNKVNIQKKNCRMEGKETVCINATVCFDV
KLKSKEDTFYEADMQYRVTLDSLRQISRSFFSGTQERKIQRNITVRESECTKHFFYMLDK
HDFRDSVRITLDFNLTDPENGPILDDSLPNSVHEHIPFAKDCGNKEKCISDLTLDVSTTE
KGLLIVRSHNDKFNVSITVKNKKDSAYNTRTIVHYSPNLIFSGIEAIQKDSCESNHNITC
KVGYPFLKRGEMVTFKILFQFNTSYLMENVTIHLSATSDSDEPLETLSDNEVNISIPVKY
EVGLQFYSSASEHHISIAANETVPEVINSTEDIGNEINIFYLIRKSGHFPMPELKLSISF
PNLTSDGYPVLYPSGWSSSDNANCRPSSLQDPLGINSKKKTIIFKSEDLKRGTILDCSSC
KFATITCNLIPSDMSQVNVSLILWKPTFIKAHFSSFNLTVKAELQSENASLVLSTGNQKR
QLAIQISKDGLPGRVPLWVILLSAFAGLLLLMLLILALWKIGFFKRPLKKKMEK
Download sequence
Identical sequences ENSPVAP00000009589 ENSPVAP00000009589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]