SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000009592 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000009592
Domain Number 1 Region: 28-108,337-645
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.06e-60
Family Integrin alpha N-terminal domain 0.000054
Further Details:      
 
Domain Number 2 Region: 165-360
Classification Level Classification E-value
Superfamily vWA-like 8.77e-52
Family Integrin A (or I) domain 0.0000000185
Further Details:      
 
Domain Number 3 Region: 927-1127
Classification Level Classification E-value
Superfamily Integrin domains 2.3e-36
Family Integrin domains 0.0027
Further Details:      
 
Domain Number 4 Region: 788-922
Classification Level Classification E-value
Superfamily Integrin domains 1.83e-25
Family Integrin domains 0.0026
Further Details:      
 
Domain Number 5 Region: 648-787
Classification Level Classification E-value
Superfamily Integrin domains 9.94e-18
Family Integrin domains 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000009592   Gene: ENSPVAG00000010172   Transcript: ENSPVAT00000010173
Sequence length 1172
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_2275:264027:343778:1 gene:ENSPVAG00000010172 transcript:ENSPVAT00000010173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPGQRGGAPLRLVLVLSQGILNCCMAYNVGLPEAKIFSGPSSEQFGYAVQQFINPKGNW
VGSRWSVFPENRMGDVYKCPVDLATATCEKLNLQTSTSIPNVTEMKTNMSLGLTLTRNMG
TRGFLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCPSLIDVVVVCDESNS
IYPWEAVKNFLEKFVQGLDIGPTKTQVGLIQYANNPRVVFNLNTFKSKAEMVAATSQTFQ
HGGDLTNTFKAIEYARHSAYAAAAGGRPGATKVMVVVTDGESHDGSMLKAVIDQCNNDNI
LRFGIAVLGYLNRNSLDTKNLIKEIKAIASIPTERYFFNVSDEAALLEKAGTIGEQIFSI
EGTVQGGDKFQMEMSQVGFSADYSPQNDILMLGAVGAYDWSGTIVQQTSHGHLIFPKQAF
DQTLQDRNHSSYLDYSVAAVSTGKSVHFVAGAPRANYTGQIVLYSVNENGNVTVIQTHRG
DQIGSYFGSVLCSVDVDKDTITDVLLVGAPMYMNHLKKEEGRVYLFTITKGILNWHQFLE
GPEGVENARFGSAIAALSDINMDGFNDVIVGSPLENQNSGAVYIYNGHENTIRTKYSQKI
LGSDGAFRSHLQYFGRSLDGFEDLNGDSITDVSIGAFGQVVQLWSQSIADVSVDASFTPE
KITLFNKNAEINLKLCFSAKFRPTKQNNQVTITYNITIDADLYSSRVTSRGLFKENNERC
LQKNMIVHQAQSCSEFIILIQEPSDVVNSLDLCVNISLENPGTSPALEAYSESAKVFSIP
FYKDCGDDGVCISDLVLDVQQLPAAQDQPFIVSNQNKRLTFSVTLKNKKESAYNTAIVVD
FSENLFFASWSMPSDGETCQVTSQKSVTCDVGYPALKRKQQVTFTINFDFNLQNLQNQAS
VSFQALSESYEENKADNSVNLKIPLLYDAEIHITRSTNIRFYEVSSDGNVPSIVHNYEDI
GPKFIFSIKVTTGSVPVSMASVIIRIPQYTKKNPLMYLTGVHTDQAGDISCNAEINPLKI
GQTSSSVSFKSEXXXHVKDLNCRTASCSNVTCWLKDPQVKGEYFLNVSTRIWNGTFAAST
FQTVQLTASAEIDTYNPQIYAIEENTVTIPITIMKPHEKAEVPTGVIVGSVIAGILLLLA
LVAILWKLGFKRKYXXXXXXXXXXXXXXELNS
Download sequence
Identical sequences ENSPVAP00000009592 ENSPVAP00000009592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]