SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000009669 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000009669
Domain Number 1 Region: 95-359
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6e-56
Family Eukaryotic proteases 0.0000701
Further Details:      
 
Domain Number 2 Region: 47-109
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000459
Family Complement control module/SCR domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000009669   Gene: ENSPVAG00000010254   Transcript: ENSPVAT00000010254
Sequence length 360
Comment pep:novel genescaffold:pteVam1:GeneScaffold_1862:308020:312413:1 gene:ENSPVAG00000010254 transcript:ENSPVAT00000010254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLHSTVLPEAEQTKMSALGVLITLLLCGQLFAVDVGSESTDNADDSCPKPPEIANGLVEH
SVRYHCKAYYRLRTEGDGVYTLNSEKQWTNKAIGEKLPECEAVCGKPKFPVDQVQRILGG
SVDAKGSFPWQAKMISHHNLTSGATLINEQWLLTTAKNLFLGHTDDAKAKDIAPTLRLYV
GKNQLVEVEKVVFHPDYSKVDIGLIKLKQKVPVGESVMPICLPSKDYAQVGRLGYVSGWG
RNNFAFTELLKYVMLPVADQHKCVIHYEKSTVPEKKEPKSPVGVQPILNEHTFCAGLSKY
QEDTCYGDAGSAFAVHDADDDTWYAAGILSFDKSCNVAEYGVYVKVPSILDWVQKTMADN
Download sequence
Identical sequences ENSPVAP00000009669 ENSPVAP00000009669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]