SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000009806 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000009806
Domain Number 1 Region: 16-193
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.3e-55
Family Eukaryotic proteases 0.000000289
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000009806   Gene: ENSPVAG00000010406   Transcript: ENSPVAT00000010406
Sequence length 193
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_2867:11307:14986:-1 gene:ENSPVAG00000010406 transcript:ENSPVAT00000010406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKTLMAALVLMAAVRAEQEKVLHGGPCEQMSHPYQAALYTSGHLLCGGVLIHPLWVLTAA
HCKKPNLRVYLGKHNIHERESFQEESSVVRAVPHPRFNAATHDQDIMLLRLRRPASLSDR
IHPLTLETDCSANHTTCHILGWGKTQDGDFPNTIQCAYVHLVPREKCMQAYPDQITRNMV
CAGDEKYGKDSCQ
Download sequence
Identical sequences ENSPVAP00000009806 ENSPVAP00000009806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]