SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000009809 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000009809
Domain Number 1 Region: 15-250
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.07e-78
Family Eukaryotic proteases 0.00000315
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000009809   Gene: ENSPVAG00000010409   Transcript: ENSPVAT00000010409
Sequence length 251
Comment pep:novel genescaffold:pteVam1:GeneScaffold_2867:36406:40809:-1 gene:ENSPVAG00000010409 transcript:ENSPVAT00000010409 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLGLVCALLAVLAGTSRADTRAIGAQECQPNSQPWQAGLFYRTHLLCGASLISDRWLLT
AAHCHKRQLWARLGEHHLWRWEGPEQLFRVKDFFPHPGFNKDLSAQDHNDDIMLIRLPRQ
ARLGPAVQPLNLSQTCVSPGTQCLISGWGAVSSPLVQYPLTLQCANISILEPILCHWAYP
GHITKSMLCAGLWEGGRGSCQGDSGGPLVCNGTLAGVVSGGSEPCSRPRRPAVYTSVCHY
VDWIRKTMEDN
Download sequence
Identical sequences XP_011381218.1.92234 ENSPVAP00000009809 ENSPVAP00000009809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]