SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000009810 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000009810
Domain Number 1 Region: 43-276
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.85e-67
Family Eukaryotic proteases 0.0000418
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000009810   Gene: ENSPVAG00000010410   Transcript: ENSPVAT00000010410
Sequence length 277
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_2867:44634:47797:-1 gene:ENSPVAG00000010410 transcript:ENSPVAT00000010410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKLPSHLHLSVASGAVAPAKLLLPLLMAQLWAAQALLPGNDTGSDPEASGAPCPRGSQPW
QVSLFNGLSFQCSGVLVDKSWVLTAAHCGNKPLWARVGDDHLLLLQGEQLRRTTVSVMHP
KYHQGSGPILPGRTDEHDLMLLKLARPAVLGPHIQTLRLPYLCARPGDQCQVAGWGTTAK
RRVKYNKGLTCSRVTILSPRECEVFLPGVVTNNMMCAGLDHGQDPCQSDSGGPLVCEDTL
QGILSWGVYPCGSAQHPAVYTQICKYTPWIEKTIRSN
Download sequence
Identical sequences ENSPVAP00000009810 ENSPVAP00000009810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]