SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000009812 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000009812
Domain Number 1 Region: 2-170
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.85e-51
Family Eukaryotic proteases 0.000053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000009812   Gene: ENSPVAG00000010412   Transcript: ENSPVAT00000010412
Sequence length 174
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_2867:56267:59342:-1 gene:ENSPVAG00000010412 transcript:ENSPVAT00000010412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RYWVRLGEHSLSRLDWTEQIRRSGFSVTHPSYQGTLQSHDHDLRLLRLGTPVILTRSVQP
LALPTSCAAAGTNCHISGWGTTSHPWNPFPDRLQCLNISIVPSATCQAVFPGRITDNMVC
AGGIAGQDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQEGIPGVYTNICNSTLP
Download sequence
Identical sequences ENSPVAP00000009812 ENSPVAP00000009812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]