SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000009813 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000009813
Domain Number 1 Region: 39-256
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.48e-62
Family Eukaryotic proteases 0.0000097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000009813   Gene: ENSPVAG00000010413   Transcript: ENSPVAT00000010413
Sequence length 269
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_2867:68403:78152:-1 gene:ENSPVAG00000010413 transcript:ENSPVAT00000010413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TWPLASAMAFLTVALSGGMSQEYPKILNGTNGTNGFLPGGYTCPPHSQPWQAALLVQGRL
LCGGVLVHPRWVLTAAHCLKTGFRVYLGKHALGRVEAGEQVRDVVRHIRHPQYQSSPTHL
HHDHDIMLLELRSPVQSTSYIRVLPLSYRDCLPPGTGCRVSGWGTTTSPQVSYPKTLQCA
DIQLRSDEECRQKYPGKITPNMLCAGTKEGGQDSCEDFDGPPCDGMLCGIFSCRDFSFGQ
PKHPGVYTVSYVLWIETIKTQEQKWKSPQ
Download sequence
Identical sequences ENSPVAP00000009813 ENSPVAP00000009813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]