SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000009814 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000009814
Domain Number 1 Region: 20-265
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.4e-83
Family Eukaryotic proteases 0.00000515
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000009814   Gene: ENSPVAG00000010414   Transcript: ENSPVAT00000010414
Sequence length 267
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_2867:86627:90531:-1 gene:ENSPVAG00000010414 transcript:ENSPVAT00000010414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLRAPVSATRRPGPRMLLPLMALQLLAVAVAQSQTDENKIIGGYTCIQHSQPWQAALLA
GPMHRFLCGGVLLSDRWAITAAHCARMILWVALGKHNLRRREATQQVLRVARQVLHPQYN
SRTHDNDLMLLRLERPARLGRAVRPIAVAQTCASPDTPCRVSGWGTTSSPAARYPNPLQC
VNINISSDQQCQRAYPGAITPGMVCAGVSQGGKDSCQGDSGGPLVCGGQLQGLVSWGMER
CAQPGYPGVYTNLCKYHTWIQQTMQSK
Download sequence
Identical sequences ENSPVAP00000009814 ENSPVAP00000009814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]