SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000009827 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000009827
Domain Number 1 Region: 129-373
Classification Level Classification E-value
Superfamily vWA-like 1.08e-85
Family Integrin A (or I) domain 0.0000000451
Further Details:      
 
Domain Number 2 Region: 371-458
Classification Level Classification E-value
Superfamily Integrin domains 8.37e-25
Family Integrin domains 0.00029
Further Details:      
 
Domain Number 3 Region: 622-705
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.2e-17
Family Integrin beta tail domain 0.0011
Further Details:      
 
Domain Number 4 Region: 21-78
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000424
Family Plexin repeat 0.001
Further Details:      
 
Domain Number 5 Region: 580-620
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000179
Family Integrin beta EGF-like domains 0.0015
Further Details:      
 
Domain Number 6 Region: 538-576
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000474
Family Integrin beta EGF-like domains 0.014
Further Details:      
 
Domain Number 7 Region: 80-154
Classification Level Classification E-value
Superfamily Integrin domains 0.00000994
Family Integrin domains 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSPVAP00000009827
Domain Number - Region: 505-538
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0112
Family Integrin beta EGF-like domains 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000009827   Gene: ENSPVAG00000010428   Transcript: ENSPVAT00000010428
Sequence length 788
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_1667:317845:384472:-1 gene:ENSPVAG00000010428 transcript:ENSPVAT00000010428 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGIELLCLFFLFLGRNDHVQGGCAMGGAETCEDCLLIGPQCAWCSQENFTHPSGVGERCD
TWANLLAKGCQLTFIENPVSQVEILTNKPLSVGRQKNSSDIVQIAPQSLILKLRPGSEQT
LQVQVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSLLSKEMSKLTSNFRLGFGSFVEK
PVSPFMKTTPEEIANPCSSIPYFCLPTFGFKHILPLTNDAERFNEIVKKQKISANIDTPE
GGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVIPNDGLCHLDSKNE
YSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDSGNI
LQLIISAYEELRSEVELEVSGDTEGLNLSFTAICKNGTFFPHQKKCSHMKVGDTASFNVT
VSIPNCERRSRRIIIKPVGLGDTLEILVTPECNCDCQKEVEVNSSKCHNGNGSFQCGVCA
CNPGYMGPRCECGEDTLSTDSCKEAPDHPSCSGRGDCYCGQCICHLSPYGNIYGPYCQCD
NFSCVRHKGLLCGDHGDCECGECVCRSGWAGEYCNCTTSTDSCLSEDGVLCSGRGDCVCG
KCVCMNPGASGPTCERCPTCGDLCNSKRSCIECHLSADGLALEECVDKCKLAGVTINEEE
DFSKDSSVSCSLQGENECLITFLITTDNEGKTIIHSINEKDCPKPPNIPMIMLGVSLAIL
LIGVVLLCIWKLLVSFHDRKEVAKFEAERSKAKWQTGTNPLYRGSTSTFKNVTYKHREKQ
KVDLSTDG
Download sequence
Identical sequences ENSPVAP00000009827 ENSPVAP00000009827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]