SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000009894 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000009894
Domain Number 1 Region: 422-728
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.98e-55
Family Eukaryotic proteases 0.0006
Further Details:      
 
Domain Number 2 Region: 123-239
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.03e-33
Family Spermadhesin, CUB domain 0.00047
Further Details:      
 
Domain Number 3 Region: 288-358
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000862
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 4 Region: 235-275
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000575
Family EGF-type module 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000009894   Gene: ENSPVAG00000010501   Transcript: ENSPVAT00000010501
Sequence length 728
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_116:321295:384252:-1 gene:ENSPVAG00000010501 transcript:ENSPVAT00000010501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELGWWPQLALTFLQLLLISSLPREYTVINEACPGAEWNIMCRECCEYDQIECICPGKKE
VVGYTIPCCRNEDNECDSCLIHPGCTIFENCKTCRNGSWGGTLDDFYVKGIYCAECRAGW
YGGDCMRCGQVMRASKGQILLESYPLNAHCEWTIHAKPGFIIQLRFVMLSLEFDYMCQYD
YVEVRDGDNNDGQIIKRFCGNERPAPIRSMGSSLHVLFHSDGSKNFDGFHAVFEEITACS
SSPCLHDGTCFLDQTGFYKCACLAGYTGQHCENKVSNNSLSVVEERNCSDPGGPVNGYKK
ITGGPGLVGGRYAKIGTIVSFFCNNSYVLSGNEKRACQQNGEWSGKQPICIKACREPKIS
DLVRRRVLPMQVQSRETPLHQLYSSAFSKQKLQSAPTKKPALPFGDLPTGYQHLHTQLQY
ECISPFYRRLGSSRRTCLRTGKWSGRAPSCIPICGKTENITAPKTQGLRWPWQAAIYRRT
SGVHGGSLHKDEWFLVCSGALVNERTVVVAAHCVTDLGKVTMVKTADLKVILGKFYRDDD
REEKTIQSLRISAVILHPNYDPILLDADIAILKLLDKARISTRVQPICLAATRDLSTSFQ
ESHITVTGWNILADVRSPSFKNDVLRSGLVRVVDSLLCEEKHDDHGIPVSITDNMFCASR
DPTAPSDICTAETGGIAAVSFPGRGSPEPHWHLVGLVSWSYDKTCSHSLYTAFTKVLPFK
DWIERNMK
Download sequence
Identical sequences ENSPVAP00000009894 ENSPVAP00000009894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]