SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000010157 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000010157
Domain Number 1 Region: 7-226
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.89e-62
Family Eukaryotic proteases 0.0000635
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000010157   Gene: ENSPVAG00000010780   Transcript: ENSPVAT00000010779
Sequence length 226
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_4031:27929:29545:-1 gene:ENSPVAG00000010780 transcript:ENSPVAT00000010779 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKESSCLRVLLLLVLGAAKTLESAACGQPRVFSRIVGGQDARAGEWPWQASIQHRGAHVC
GGSLIAPQWVLTAAHCFPRQALLSEYRVRLGALHLGPASPRALLVPVRRMLLSPDYSEDR
ARGDLALLQLHRPVPLSSRVQPVCLPEPRAHLPPGTLCWVTGWGSLHPGVPLPEWRPLQG
VRVPLLDSHTCDRLYHVGTNVPLAQHIVLPGNLCAGYVQGHKDACQ
Download sequence
Identical sequences ENSPVAP00000010157 ENSPVAP00000010157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]