SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000010159 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000010159
Domain Number 1 Region: 47-296
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.57e-87
Family Eukaryotic proteases 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000010159   Gene: ENSPVAG00000010781   Transcript: ENSPVAT00000010781
Sequence length 318
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_4031:31686:40330:-1 gene:ENSPVAG00000010781 transcript:ENSPVAT00000010781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTWVGVLLLAQLLVRAELEMQGELRPELPADLGVMGRMGRGDRGGPCGHPNIHPLVTGG
KDSLHGRWPWQASLRFSKGHTCGGSLLNRRWVVSAAHCFEKHRDPSEWMVQLGELSAKPP
FWNLRAFYHRYKVQDIFMHPYFRGFLLNDIALLRLSSSVTYNKYIRPICVLASSADFQNR
TDCWVTGWGQIREDMAELPSPYKLQEVQVSIINNSRCNQMFQRPNRIWEDMICAGFENGG
RDACRGDSGGPLTCEENGLWYQIGIVSWGIGCGRPNRPGVYTNVSRYFTWIRMIMAHSTP
RPDPCPLLLLLVLLWAAL
Download sequence
Identical sequences ENSPVAP00000010159 ENSPVAP00000010159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]