SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000010199 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000010199
Domain Number 1 Region: 168-451
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 4.45e-28
Family Integrin alpha N-terminal domain 0.002
Further Details:      
 
Domain Number 2 Region: 1-185
Classification Level Classification E-value
Superfamily vWA-like 3.25e-26
Family Integrin A (or I) domain 0.00000577
Further Details:      
 
Domain Number 3 Region: 595-732
Classification Level Classification E-value
Superfamily Integrin domains 1.57e-17
Family Integrin domains 0.012
Further Details:      
 
Domain Number 4 Region: 457-596
Classification Level Classification E-value
Superfamily Integrin domains 0.0000000000000293
Family Integrin domains 0.013
Further Details:      
 
Weak hits

Sequence:  ENSPVAP00000010199
Domain Number - Region: 815-880
Classification Level Classification E-value
Superfamily Integrin domains 0.000199
Family Integrin domains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000010199   Gene: ENSPVAG00000010817   Transcript: ENSPVAT00000010822
Sequence length 963
Comment pep:known_by_projection scaffold:pteVam1:scaffold_12636:12922:31497:1 gene:ENSPVAG00000010817 transcript:ENSPVAT00000010822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPNQAMDFVLLINDCGSIGQSDFKQMRALMDQFEGTNTLISLMKYSNFLEIHFFTAFQTS
FSPQSLVDPTVQLNELTFTATGILTMVKELFHSKNGACKSAKKILIVITDGQKYKDSLKY
SDIISLAEIVGIIRYAIRVGDAFQEPTTRQELNTIGSMPSQNHTFKVDNFAAHGSIQKQL
QEKIFAVKRTQLKRSSSFQEMSQEGFGSVLTVDGPVPGLLGSFSWPGYAFLYPPNIHVHM
RDSYLGYSTELALWKGVQSLVLGTPHHQHTRKVVLFAQVSGQWRPKAEVTGIGSYFGASL
CSVDVDRDGSSDLVLTGTPHYEPTRGGQVSVCSFPRGQRAKWQCEFILCGEQGHPGRFGE
ALTVLGNVNRDKLMDMAIGALGEQENQSAVYLFHKTSGLGIPFHSKRMAGCQFSPRLQNL
GQSLSLGQNVTQDGLADLIERAQGHVLLLRCLPGLIVGVAIRFMPIEVVKAVYCRKSWFN
SREAGNVTVCLTICQKLLQLGDVQSSVRYNMTLDAGCLISRAIFDKAKNWTLTQRKTLGL
RNHCEIMKLLLPDCTEDVVNPIILHLNFPSSQNFCPVLAMGSQDLFTASLPFKNCGQDLL
FEEDLNVLQSLVVRSSLENVIVTLWNEGEDSYRTVINFYDPAGLSYRVLGIQKQPHQCPL
HLACEAVPTENEEGLRSISCSINHFEGTKGTFIVTFDASYKAILGDKLLLRVNASSENNK
PTTSKTTLQLEFLVNYAIYTVSSRQEESTKHFNFSTSDEKSRKEAEHRYPVNNLSQRDLA
ISINFLLNSVAVDVAMVAPSSLSCVSEMEPLQHSNFTQIPRSLVLDCSIADCLRFCCDIP
SFGTQEELDFILKGNLSFGWIGQTLQKKVLVVSVAEIMFSVYPQLPGQEAFSRAQMEDEV
YDPILIVGSSVGGLLLLVLITATLYKLGFFKRQYKEMLDDKPEDTVTFSGENFSCEALNL
PLS
Download sequence
Identical sequences ENSPVAP00000010199 ENSPVAP00000010199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]