SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000010326 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000010326
Domain Number 1 Region: 8-275
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.31e-83
Family Eukaryotic proteases 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000010326   Gene: ENSPVAG00000010956   Transcript: ENSPVAT00000010956
Sequence length 333
Comment pep:known_by_projection scaffold:pteVam1:scaffold_4679:13567:20357:1 gene:ENSPVAG00000010956 transcript:ENSPVAT00000010956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGPAGCAFLLSLLLGSCPSSSSKKKDLQSVCGRPVYSGRVMGGQDAAVGHWPWQVSLHIG
ESHICGGSLINKRWILTAAHCIKTTWFPLLYTVWLGTIKIGYSNNGVKHHVSKIIIHPKF
QDSTADIALLKLVSRVTFTPFILPICLPSITKQLTIPGSCWVTGWGNKNSNYHSTLQEVE
VPIINRQACERLYNPISFILPESEPVISEDMICAGDTHKMKDSCKGDSGGPLSCHIDGVW
ILIGLVSWGTECGKSLPGVYTSVIYYQKWINATISRANNLDLSDFLFSIVQLSLAPLGPS
CALNILPGVGSIAATGQGQGKGSTWRTCSRVRE
Download sequence
Identical sequences ENSPVAP00000010326 ENSPVAP00000010326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]