SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000010499 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000010499
Domain Number 1 Region: 173-372
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.31e-55
Family Prokaryotic proteases 0.000000882
Further Details:      
 
Domain Number 2 Region: 391-477
Classification Level Classification E-value
Superfamily PDZ domain-like 8.15e-19
Family HtrA-like serine proteases 0.0023
Further Details:      
 
Domain Number 3 Region: 38-125
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000895
Family Growth factor receptor domain 0.0049
Further Details:      
 
Domain Number 4 Region: 110-157
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000864
Family Ovomucoid domain III-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000010499   Gene: ENSPVAG00000011138   Transcript: ENSPVAT00000011138
Sequence length 480
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_2112:163993:175198:1 gene:ENSPVAG00000011138 transcript:ENSPVAT00000011138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRPLLCLAGLGQFLLLWLLPPLVPVPRVEAQRTWTSLFCPVACEPMRCPPLPTCSSGAM
PVLDRCQCCRVCAAAEGEVCGGARGRPCAPGLQCGAPFSPRRLGGARLGTCGCPAVGAAV
CGSDGRTYPSLCALRAENRAARRRGALPAVPVQKGDCGDPGTRGAGRPRSKYNFIASVVE
KVAPSVVHLQLFRRSPLSNKDIPASSGSGFIVSEDGLIVTSAHVLTNHQRIQVELQSGVQ
YEATVKDIDHKLDLALIKIEPNTDLPVLLLGRSSDLRAGEFVVALGSPFSLQNTVTAGIV
STTQRGSKELGLKDSDIDYIQTDAIINHGNSGGPLVNLDGDVIGINTLKVTAGISFAIPS
DRIRQFLEEFHERQLKGKALSQKYLGLRMLLTMNLLQDMKRQNPDFPDVSSGVFVYEVIQ
GTAAESSGLRDHDVIVSINGQPVTTTTDVIEAVKDNDSLSIVVHRGSQTLILTVTPEITD
Download sequence
Identical sequences ENSPVAP00000010499 ENSPVAP00000010499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]