SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000010580 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000010580
Domain Number 1 Region: 15-254
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.34e-67
Family Eukaryotic proteases 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000010580   Gene: ENSPVAG00000011224   Transcript: ENSPVAT00000011224
Sequence length 299
Comment pep:novel genescaffold:pteVam1:GeneScaffold_4023:3669:13672:-1 gene:ENSPVAG00000011224 transcript:ENSPVAT00000011224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPEPELSVLLMGRGVSTVCGKPKVMSKIYGGQDVVAGQWPWQASLLYRNLHICGAVLIDA
RWLVTTAHCFVNKSHAPEDYLVTLGSTQLYQHTQHTRKMYVSRIITHPSFEKFHAFGNDI
AMLQLHLPVNFTSYISPACLPTAGMQLPIHRSCWITGWGMLSEDSETLSSSESPPVDRFR
SMIFESQVHIGWVCRGLLTWTVETHGDSGGPLVCDLLSSWVLVGLASWGLDCRHPIYPSV
FTNVTYFADWINDIQRLTPLPDPTQFSYQPLQAASSPGPGTALMTPQTWLPLMFVLRTM
Download sequence
Identical sequences ENSPVAP00000010580 ENSPVAP00000010580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]