SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000010638 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPVAP00000010638
Domain Number - Region: 134-183
Classification Level Classification E-value
Superfamily UBA-like 0.000446
Family CUE domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000010638   Gene: ENSPVAG00000011284   Transcript: ENSPVAT00000011284
Sequence length 279
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_844:161121:163153:-1 gene:ENSPVAG00000011284 transcript:ENSPVAT00000011284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELERIVSAALLAFVQTLPADLGLDEVIFSYVLGVLEDLGPSGPSEENFDMEAFTEMMEA
YVPGFAHIPRGAIGDMMQKLSEQLSGARNKENLQPQSSKVQGHVPISTEPLQRPEKLKEE
TRASAARDTQDEASGAEEELLPGVDVLLEVFPTCSVEQAQWVLAKARGDLEEAVQMLVEG
KEDGPPAWDGPNQDQPRHLRGPQKDELKSFILQKYMMVDSAEDQKIHRPMAPTEAPKKLI
RYIDNQVVSTKGERFDVRPEAEEMSTYINLKPARKYRFH
Download sequence
Identical sequences ENSPVAP00000010638 ENSPVAP00000010638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]