SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000010802 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000010802
Domain Number 1 Region: 849-1034
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.12e-54
Family Eukaryotic proteases 0.00017
Further Details:      
 
Domain Number 2 Region: 453-574
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 2.62e-36
Family Frizzled cysteine-rich domain 0.00011
Further Details:      
 
Domain Number 3 Region: 137-203
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.000000000000209
Family Frizzled cysteine-rich domain 0.0085
Further Details:      
 
Domain Number 4 Region: 304-343
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 5 Region: 346-378
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000563
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 6 Region: 653-691
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000982
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 7 Region: 580-615
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000982
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 8 Region: 619-651
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000223
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 9 Region: 686-786
Classification Level Classification E-value
Superfamily SRCR-like 0.00000746
Family Scavenger receptor cysteine-rich (SRCR) domain 0.09
Further Details:      
 
Weak hits

Sequence:  ENSPVAP00000010802
Domain Number - Region: 269-293
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00249
Family LDL receptor-like module 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000010802   Gene: ENSPVAG00000011458   Transcript: ENSPVAT00000011459
Sequence length 1041
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_2013:83930:244135:-1 gene:ENSPVAG00000011458 transcript:ENSPVAT00000011459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRSPALAPDERYRRARAPEPVLVSDEDNLNDGCSQKLTTTNILRFLLLVLIPCICALIV
LLVILLSFVGTLKKAHFKSNGSEPMATDGKNRTPDIILRNMIYNESEVTSATHPDQYMSA
WTKNISLPRDQNHKNTSTCMNITHSQCQMLPYHTTLTSLFPIVKKMDMEKFLKFFTYLHR
LSCYQHIMLFGCSLAFPECVSDGDDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXLCGGGESFLCGSGTCIPRTLLCNGYNXXXXXXX
XXXXXCSENLFHCHTGKCLNYSLVCDGYDDCGDLSDEQNCDCNLTKEHRCGDGRCIMMEW
VCDGDHDCVDKSDEVNCXXXXXXXXXXXXXXXXXXXXXXXXXEDCKDRSDEEGCSSSQTP
CQEGDQRCLYNSCLGSCDGSSLCDTNNSLNNCSQCEPITLELCMNLPYNHTYYPNYLGHR
TQKEASISWESSLFPALVQTNCYKYLMFFACTILVPKCDVNTSQRIPPCRALCEQSKERC
ESVLGIVGLQWPEGTDCNQFPEENSDNQTCLMPNEDVEECSSHFKCGSGRCVLASRRCNG
EPDCDDDSDEENCGCKERNLWECPTDKQCLQHTVVCDGFPDCSDHMDEKNCSFCQDDELE
CANHECVSRDQWCDGEANCLDSSDEWDCVSLSKNVDSFSFLTVYRSATEHLVCGDGWQET
LSQLACKQMGLGEPSVTELIQEQKQDQQWLILHSNWKSLNGTTLHELLVKGQSCHSRSKI
YLLCTKQDCGRRPAARMNKRILGGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXRETAADWKVVFGINNLDHPSSYIQTRLVKTIILHPRYSRAVVDYDISIVELGED
ITETSYVRPVCLPSMLQSLEPDTYCYITGWGHMGHKMPFKLQEGEVRVISLQQCQSYFDM
KTITTRMICAGYESGTVDSCMGDSGGPLVCEQPGGQWTLFGLTSWGSVCFSKVLGPGVYS
NVSYFVEWIERQIYIHTFLLK
Download sequence
Identical sequences ENSPVAP00000010802 ENSPVAP00000010802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]