SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000011177 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000011177
Domain Number 1 Region: 199-445
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.61e-82
Family Eukaryotic proteases 0.0000000631
Further Details:      
 
Domain Number 2 Region: 42-98
Classification Level Classification E-value
Superfamily GLA-domain 4.04e-20
Family GLA-domain 0.00035
Further Details:      
 
Domain Number 3 Region: 136-185
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000395
Family EGF-type module 0.00066
Further Details:      
 
Domain Number 4 Region: 98-135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000061
Family EGF-type module 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000011177   Gene: ENSPVAG00000011859   Transcript: ENSPVAT00000011859
Sequence length 456
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_1061:36124:44595:1 gene:ENSPVAG00000011859 transcript:ENSPVAT00000011859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWQLASLLLFLTIWGISSTPVNPGSVFSSSEQAHQVLRIHKRANSFLEELRPSSLERECM
EEMCDFEEAQEIFKNVDHTLAFWSKYLDDDQCKVQPPEHPCDSACCGHGTCIDGIGGFRC
DCGQGWEGRFCLHEVRFSNCSVDNGGCAHYCLEEGGGRRCSCAPGYLLGDDHLQCEPNVK
FPCGKLWNPMEKKGKILKCCTDQADQVDPRLVNGKMTIQGESPWQVILLDSKKKLACGAV
LIHTSWVLTAAHCMEDSKKLTVRLGEYDLRRREKWEVDLDIKEVLMHPNYSKSTNDNDIA
LLRLARPATFSQTIVPICLPDSGLSERELTKVGQETVVTGWGYRSETKRNRTFVLNFIKI
PVAPRNECVQAMHHRVSENMLCAGILGDPRDACEGDSGGPMVASFRGTWFLVGLVSWGEG
CGRLHNYGIYTKVGHYLDWIHSYVGAEEASLESQVP
Download sequence
Identical sequences ENSPVAP00000011177 ENSPVAP00000011177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]