SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000011267 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000011267
Domain Number 1 Region: 41-128
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.66e-30
Family SCAN domain 0.00012
Further Details:      
 
Domain Number 2 Region: 1184-1205,1235-1262
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000226
Family Classic zinc finger, C2H2 0.034
Further Details:      
 
Domain Number 3 Region: 555-579,606-633
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000305
Family Classic zinc finger, C2H2 0.037
Further Details:      
 
Domain Number 4 Region: 1290-1313,1451-1478
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000116
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 5 Region: 1065-1088,1117-1144
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000191
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 6 Region: 411-474
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000398
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 942-971
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000303
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 8 Region: 649-699
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000528
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 9 Region: 479-531
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000721
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 10 Region: 1513-1541
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000134
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Weak hits

Sequence:  ENSPVAP00000011267
Domain Number - Region: 1006-1034
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00294
Family Classic zinc finger, C2H2 0.066
Further Details:      
 
Domain Number - Region: 794-828
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 0.0876
Family Small-conductance potassium channel 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000011267   Gene: ENSPVAG00000011956   Transcript: ENSPVAT00000011955
Sequence length 1541
Comment pep:known_by_projection scaffold:pteVam1:scaffold_2096:96993:108539:1 gene:ENSPVAG00000011956 transcript:ENSPVAT00000011955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPPKYLSASKPKRSWAPDLYELDSDLTKEPDAIIGGGAADSEFFHQRFRNFLYVEFVGP
RKTLIKLRNLCLDWLQPETHTKEEIVELLVLEQYLTILPERIKPWVRAKKPQSCEKLVTL
LESYKEMYEPEDSSGDGHSEDSMSREGAASPPPRSACFDRDWDRRGRSRDLEFRDRWPYT
RNPRSRLPQRDLSLPVMEKTFAMERGHRRRDCMMDYESRSQDAVSYQDVVDLTEDRKPQN
PIQDNMENYRKLLSLVQLAEDDGHSHMTQGHSSRSKRSVYPSTSRGLKTMPETKKSAHRR
GICEDESSHGVIMEKFIKDVSRNPRSGRARECNDRSPRFPRRPDHDWRDISFNKRESVIQ
ERGYEGSAFGGGSKCNPNLVSRKRVLERKRRYQFDIDGQGSIHDQKVCPRKRPFECSEMR
KATSTSSLSSPSFTVSQPLDFGAMPYVCDECGKAFSVISEFVEHQIMHTRENLYEYGESF
IHSVAVSEVQKRQARGKCFECKECGETFNKSAALAEHRKIHVRKYLTEYNEDEYEEPFMP
SPTFSELQKIYGKDKFYQCKVCKETFLHSSALIDHQKTHGRDDKDTVRGEAFKPSPPLSE
LQKMYAKEKMYECKVCRETFHHSSALKEHQKIHTRANLFESKGKVCEETFIPSQSLKRRQ
KSYSKEKLYDFKDGGVTFRQSSELTEHQKIHSRKNLYESRGYEKSVIRSVPCTDSQKSHT
ITRPPENGSEKAFTISSNPDDNQKLPTQNVCERKPYERSVIHSLAFAKAQRSHSTGGTNK
PKVIAESTIQSSSVVEHQKVHTRENASERKKYQRSVIHSLAAFRAPKSRSGSEFECSERG
ESSIYISDLREQQKAPARENPYEGCENNNCKDSVIRSVARAEPQKGLNAEGDSEYKKDGQ
SVSTVNVREHQKARAKKKNIERRNCETSVIHSLRFGEPQTFLPREKFYECLECGESFVHS
SDLTEHQKIHDRKKTSGSRNYERSVIRSLASTDPQTSYAEQQYVQQPAQKECHECGQCFA
TIEDLSAHQKIYAQEEFHGGKQLGDSVIQGVGPDRPEQGDPEDTIYGCKDCGLGFADRAD
LKDHQKVHGREYLIDTREYTHSVIHTHSVSEYQRDYTGEQLYECPACGECFVHSSFLFEH
QKVHEQDQFYGHRRYDEPFVQPLVINPQRPRAPQKNPSTGLFLQCHVCGQDFIHGSVLND
HMTVHTGGNSPEQGQGSGNAVSPGLALTELQRSQAEEKHYECETCGESFLSQSDLKDHMR
IHEKDEPYDYGAAFVHTSFLTEPPKRDSSFFECKDCGKSFIHNTVLTKHQKFHVEEEEAA
AQEVEASVLVPREVLRIQGSNVEAAEPEVEATEPEVEAAEPEVEAAEPNGEAEGPDGEAA
EPNGEAEQPNGEAEQPNGDADEPDGAGIEDPEERAEEPAGKAEEPEGDTDEPDGAGIEDP
EEEGDDQEIQVEEPYYDCRECGETFASNSAYGEHLKTHARVIIFEPGSIYGESSHYTEHA
STSTSASDNDRADDKYFKCDVCGQLFGDRLSLARHQNTHTG
Download sequence
Identical sequences ENSPVAP00000011267 ENSPVAP00000011267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]