SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000011510 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000011510
Domain Number 1 Region: 35-122
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 5.49e-33
Family SCAN domain 0.000049
Further Details:      
 
Domain Number 2 Region: 343-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000018
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 512-538
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000108
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 4 Region: 222-255
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000262
Family KRAB domain (Kruppel-associated box) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000011510   Gene: ENSPVAG00000012212   Transcript: ENSPVAT00000012211
Sequence length 543
Comment pep:known_by_projection scaffold:pteVam1:scaffold_8267:36464:44378:-1 gene:ENSPVAG00000012212 transcript:ENSPVAT00000012211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKERPGMAEDPQQQMGVPVVKLEKELPWGRGREDPSPEIFRLRFRQFRYQEAAGPQEAL
RELQELCRQWKPELHTKEQILELLVLEQFLTILPREFYAWIREHSPDSGKALVAMVEDFT
ERALEAKAVPCHMQGQQEETALCRGPWEPGVHLGPVEVKPEWGMSHGEGVQSLDQGTEEQ
LNQAPGAGTQTFQELPILQAGPSLSTVNTRDQEMAAGFLSAGSQGLGPFKDMALAFPEEE
WRHVTPAQIDCFGEYVEPQDCGVSPPGGGSKEKEAKTQPADLKGALAQGTSERFGEAALQ
SPELGRTCEQESSSSVGNVPGPPPPQRGILPLPDDLTTHGSFWKPFQCPECGKGFSRSSN
LVRHQRTHEEEKSYGCVEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPYHCPACGRSFNQRSILNRHQKTQHRQEI
QMQ
Download sequence
Identical sequences ENSPVAP00000011510 ENSPVAP00000011510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]