SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000011606 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000011606
Domain Number 1 Region: 58-244
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.2e-57
Family Eukaryotic proteases 0.00000381
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000011606   Gene: ENSPVAG00000012312   Transcript: ENSPVAT00000012313
Sequence length 246
Comment pep:novel genescaffold:pteVam1:GeneScaffold_602:10910:14142:-1 gene:ENSPVAG00000012312 transcript:ENSPVAT00000012313 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPLLLLLAFLLPRGAETXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVL
TAAHCSGSSINVTLGAHNIKKQEKTQQVFRVVKAIPHPDYNPKNFANDIMLLQLKRNIKL
TKAVKPLRLPKGEDQVRPGQKCSVAGWGRVAIGTLATTLQEVELTIQKDRECKSCFPHYY
SKDSQICVGDPKKKKTGFKGDSGGPLMCNNTVQGIFSYAKMDKEPPGVFMNVSHFLTWIK
RTMKRP
Download sequence
Identical sequences ENSPVAP00000011606 ENSPVAP00000011606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]