SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000011678 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPVAP00000011678
Domain Number - Region: 61-99
Classification Level Classification E-value
Superfamily Snake toxin-like 0.00107
Family Snake venom toxins 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000011678   Gene: ENSPVAG00000012388   Transcript: ENSPVAT00000012388
Sequence length 125
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_3921:121727:124047:-1 gene:ENSPVAG00000012388 transcript:ENSPVAT00000012388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGRLLFALSSLFCWVSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKMWVF
SNLRCGTPEEPCREVFNQTSHKLGLTYNTTCCNKDNCNSPAPRPTPAIALVLLTSLAGLG
LWLLH
Download sequence
Identical sequences ENSPVAP00000011678 ENSPVAP00000011678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]