SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000011825 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000011825
Domain Number 1 Region: 46-275
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.13e-40
Family Eukaryotic proteases 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000011825   Gene: ENSPVAG00000012541   Transcript: ENSPVAT00000012542
Sequence length 388
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_701:16943:29621:-1 gene:ENSPVAG00000012541 transcript:ENSPVAT00000012542 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVXXXXXXXXXXXXXXXXXXXXXXXXXXXCGVQNTKSLETSEEGLVSEKEFPWIVSLQDS
HYTHLTFGSILSQFWILSIASAFQNRKDAVAIVGIAKMDGRVIAHEEYPINKIVIHEDFD
NVTMTNNIALLKTDTAMHFNNLVGSICFLGRKLHLSSALRNCWVAGWNPTTATGHHMTMS
ILRKISVKNIDLCPLHNYKKTGCGYHVEEETDAVCLGDPGNPMMCQLQHLNLWVLRGILS
KGGEKCPGLFLYIRVEDYSTWITSKTKRTGLPMSVLHHWEHSIPFFSNSSNASAAHAKNS
AGQGYMVPYFQGQREATIHTGPHSSTHNLDFNEXXXXXXXXXXDTAGQPMYYDYYGGEAG
LSGQNGVRQPQEIILISFLLVFFCSGMQ
Download sequence
Identical sequences ENSPVAP00000011825 ENSPVAP00000011825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]