SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000012056 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000012056
Domain Number 1 Region: 512-773
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.25e-90
Family Eukaryotic proteases 0.000000017
Further Details:      
 
Domain Number 2 Region: 258-365
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.24e-27
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 3 Region: 133-251
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.8e-20
Family Spermadhesin, CUB domain 0.0023
Further Details:      
 
Domain Number 4 Region: 6-94
Classification Level Classification E-value
Superfamily SEA domain 0.00000000000183
Family SEA domain 0.0069
Further Details:      
 
Domain Number 5 Region: 372-407
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 6 Region: 444-478
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 7 Region: 407-444
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000576
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 8 Region: 483-523
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000266
Family LDL receptor-like module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000012056   Gene: ENSPVAG00000012778   Transcript: ENSPVAT00000012782
Sequence length 774
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_2235:326209:343555:1 gene:ENSPVAG00000012778 transcript:ENSPVAT00000012782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RNVQVQKIFNGYLRVKNENFLDAYENPNSTEFAELANKVKEALKLLYRGIPALGPYHKES
AVTAFSEGSIIAYYWSEFSVPSYLVEEAERAMAEERTIRLPPRTRTLRSFMLTSVVAYXX
XXXXXXXXXXXSCRFALHARSGELTRFTTPGFPDSPYPAFSRCQWTLRGDASSVLSLTFR
SFDVATCDDRGSDMVVVYDTLSPVEPRAVVQLCGTYPPSYNLTFLSSQNVLLVTLITSTG
RRHPGFEAMFFQLPKMSSCGGYLREAQGTFSSPYYPGHYPPNINCTWDIEVPNNRNVKVF
FKLFYLLEPSVPLGTCPKDYVEVNGEKFCGERSQFVVASKSSKITVHFHSDQSYTDTGFL
AEYLSYDSSDPCPGKFMCNTGRCIRNELRCDGWADCADYSDELNCKCNATYQFTCKNKFC
KSLFWICDSVNDCGDNSDELECSCPAETFKCSNGKCIPKSQQCDGKDNCGDRSDEATCDS
VDVVTCTKNTYRCQNGLCVSKGNPECDGKKDCSDGSDEKDCDCGLRPFSRQSRVVGGKDA
DEGEWPWQVSLHALGQGHVCGASLISPSWMVSAAHCFINDKGFRYSDHTMWTAFLGLHDQ
SKRSASGVQERKLKRIISHPYFNDFTYDYDIAVLELEQPVEYSSTVRPICLPAASHSFPA
GKAIWVTGWGHTYEGGTVVLILQKGEIRVINQTTCEKLLPQQITPRMMCVGYLSGGVDAC
QGDSGGPLSSVEADGRIFQAGVVSWGDGCAQRDKPGVYTRLPVLRDWIKEQTGV
Download sequence
Identical sequences ENSPVAP00000012056 ENSPVAP00000012056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]