SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000012331 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000012331
Domain Number 1 Region: 313-473,513-587
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.87e-33
Family Viral proteases 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000012331   Gene: ENSPVAG00000013075   Transcript: ENSPVAT00000013076
Sequence length 595
Comment pep:known_by_projection scaffold:pteVam1:scaffold_18935:6360:10495:-1 gene:ENSPVAG00000013075 transcript:ENSPVAT00000013076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSEKRRSQKASSTLKNNKKIDQYFPQVNKEQENISSIPQMKTSSRKGPEDITDQATSTD
MVIHITLDVHHRKNKKMKHKLRHPQSGSLYEALNTLRAVKEEVKTHQGKEMLVRGMEGIE
GYLNLGMPLSCLPGECHLIITFAQSKSKEKEENQIFGRHDRASTDCVKFFIHVIGKRTKR
IVKCGELHKEGHKLCVFAFKGETIKDAVCKDGRFRSFLENDYWKLIENLDSVVENTQPVV
DDLEGKLFQVEVEKGMGTWTPAPQNTKSETRNSSESKEATMTQYPSLQRECEKIRESFDK
QMKKEKKLFQLHKTNFGKLTKNSTPVKTHKLLSHLSNSVGYIWWDNNGNVGSATCFVFRG
LYIFTCQHVIENIVGRGIERSKWAEIIGQCVRVTFDYVEPKDEEYFCVEPWFEVSDGTLD
YAVLQLKENGQQVPSGLYDGIVPVPPNGLIYIIGHPSGEAKSTDACAIIPQGEREEKCQE
HLQARKAEGCSDIQYIRMYTQNSFQEMVHRIDLITYNTTFYFGSSGSPVFDAKGSLVAMH
SAGFAYNYQKGHSSIIEFGPTMESILHHIKQNYGMWYEDVCITQQEVEMLSDEDG
Download sequence
Identical sequences ENSPVAP00000012331 ENSPVAP00000012331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]