SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000012720 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000012720
Domain Number 1 Region: 402-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1e-24
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 2 Region: 737-794
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.56e-24
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 3 Region: 598-654
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.69e-23
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 4 Region: 880-934
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.75e-23
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 5 Region: 794-850
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.95e-23
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 6 Region: 513-570
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.69e-22
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 7 Region: 458-514
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.27e-20
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 8 Region: 653-710
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.82e-20
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 9 Region: 208-266
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.66e-20
Family KRAB domain (Kruppel-associated box) 0.0022
Further Details:      
 
Domain Number 10 Region: 923-975
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.78e-18
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 11 Region: 361-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-16
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 12 Region: 840-872
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000344
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 13 Region: 700-732
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000155
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 14 Region: 560-592
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000156
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 15 Region: 37-80
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.0000000549
Family SCAN domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000012720   Gene: ENSPVAG00000013486   Transcript: ENSPVAT00000013485
Sequence length 1021
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_3579:2545:12967:1 gene:ENSPVAG00000013486 transcript:ENSPVAT00000013485 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRENLAHNALRQEGLVKGKDDTWKWGTSFQGSSSSVWETSHLHFRQLRYHETSGPHALS
RLRELCRRWLPEARTKAQILXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXVPVLDQDQDTLQEGMGTPGTALLQAPSGSHIAEICPSPLTDPVVVNPQDPPH
GSPAREASALSQEENPRNQLMALMLLTAQPQELVMFEEVSVCFTSEEWACLGPIQRALYW
DVMLENYGNVTSLEWETMTENEEVTSKSSISQRADSQKGTSKRLQGGIPQVLDFEKERKW
QVLASRWKNETERDTLKKGSFHERDKKKRTPPEKRSQKGKEFGESLTLYSAVSESLMGTE
GKKFYKCDICCKHFNKISHLINHRRIHTGEKPHKCKECGKGFIQRSSLLMHLRNHSGEKP
YKCNECGKAFSQSAYLLNHQRIHTGEKPYKCKECGKGFYRHSGLIIHLRRHSGERPYKCN
ECGKVFSQNAYLIDHQRLHKGEEPYKCNKCQKAFILKKSLILHQRIHSGEKPYKCDECGK
TFAQTTYLADHQRLHSSENPYKCKECGKVFIRSKSLLLHQRVHTEKKTFGCKKCGKIFNS
KSNLIDHKRIHSREKPYKCTECGKAFTQSAYLFDHQRLHNGEKPYECNECGKVFILKKSL
ILHQRFHTGENLYECKDCGKVFGSNRNLIDHERLHNGEKPYECRECGKTFIMSKSFMVHQ
KLHTQEKAYKCEDCGKAFSYNSSLLVHRRIHTGEKPFECGECGRAFSSNRNLIEHKRIHS
GEKPYECNECGKCFILKKSLIGHQRIHTREKSYKCSDCGKVFSYRSNLIAHQRIHTGEKP
YACNECGKGFTYNRNLIEHQRIHSGEKTYECHICRKVLTSSRNLMVHQRIHTGEKPYKCN
ECGKDFSQNKNLVVHQRMHTGEKPYECEKCRKSFTSKRNLVGHQRIHTGEKPYGCNDCSK
VFRQRKNLTVHQKIHTDEKLCECDESVQEFSTTSNHLQQKICTMEEFSWLQNEPKIEIQK
T
Download sequence
Identical sequences ENSPVAP00000012720 ENSPVAP00000012720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]