SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000012850 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000012850
Domain Number 1 Region: 13-425
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 3.14e-74
Family Integrin alpha N-terminal domain 0.00000339
Further Details:      
 
Domain Number 2 Region: 444-603
Classification Level Classification E-value
Superfamily Integrin domains 4.5e-29
Family Integrin domains 0.0032
Further Details:      
 
Domain Number 3 Region: 674-745
Classification Level Classification E-value
Superfamily Integrin domains 0.0000000000377
Family Integrin domains 0.012
Further Details:      
 
Weak hits

Sequence:  ENSPVAP00000012850
Domain Number - Region: 852-912
Classification Level Classification E-value
Superfamily Integrin domains 0.000282
Family Integrin domains 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000012850   Gene: ENSPVAG00000013621   Transcript: ENSPVAT00000013622
Sequence length 1018
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_1989:18307:271435:1 gene:ENSPVAG00000013621 transcript:ENSPVAT00000013622 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LALVAVGPPAGAYNLDPQRPVRFQGPAGSFFGYPVLEHFHANTRWVLVGAPKADSKYSTS
VKSPGAVFKCRVHTNPDRRCTELDMARGKNRGMSCGKTCREDRDDEWMGVSLARQPKADG
RILACAHRWKNIYYETDHILPHGFCYIIPSNLQAKGRTLIPCYEEYKKKYGEEHGSCQAG
IAGFFTEELVVMGAPGSFYWAGTVKVLNLTDNTYFKLNDEAIMNRRYTYLGYAVTAGHFS
HLSTTDVVGGAPQDEGIGKVYIFRADRRSGTLIKIFQASGKKMGSYFGSSLCAVDLNADG
LSDLLVGAPMYSEIRDEGQVTVYINRGNGALEEQLALPGDGAYNAHFGESIASLGDLDDD
GFPDVAIGAPMEEDFSGAVYIYHGDLGGIVPQYSMKLSGRKISPVLRMFGQSISGGIDMD
GNGYPXXXXXXXXXXXXXXXXARPVITVVSSIFLPASINITAPQCHDGLQPVNCLNVTAC
FSFHGRHVPGEIGLNYILTADVAKKEKSQLPRVYFVLHGESVGQVSEKLHLVHMEETCHH
YVAHVKRRVQDVISPIVFEAAYSLGEHVTGEEDRELPALTPVLRWKKGQKIAQKNQTVFE
RNCRSEDCAADLQLQGQLLLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXEEMGISCELLESDFLKCSVGFPFMRSKSKYEFSVIFDTSHLSGEEEVL
SFIVTAQSGNVERSESLHDNTLTLTVPLMHEVDTSVTGIMSPTSFVYGESVDASSFIQLD
DLECHFQPLNVTLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVGQEKGNCSF
QRNPTPCIIPQEQENIFHTIFAFFTKSGRKVLDCEKPGISCLTMHCNLSALAKEESRTID
IYMLLNTEILKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVFEALHNLEPRGY
VVGWIIAISLLVGILIFLLLAVLLWKMGFFRRRYKEIIEAEKNRKENEDSWDWVEKSQ
Download sequence
Identical sequences ENSPVAP00000012850 ENSPVAP00000012850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]