SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000013088 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000013088
Domain Number 1 Region: 365-609
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.09e-67
Family Eukaryotic proteases 0.00032
Further Details:      
 
Domain Number 2 Region: 196-302
Classification Level Classification E-value
Superfamily Kringle-like 9.91e-32
Family Kringle modules 0.00043
Further Details:      
 
Domain Number 3 Region: 35-89
Classification Level Classification E-value
Superfamily Kringle-like 9.69e-19
Family Fibronectin type II module 0.0065
Further Details:      
 
Domain Number 4 Region: 96-135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000182
Family EGF-type module 0.031
Further Details:      
 
Weak hits

Sequence:  ENSPVAP00000013088
Domain Number - Region: 132-170
Classification Level Classification E-value
Superfamily FnI-like domain 0.0351
Family Fibronectin type I module 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000013088   Gene: ENSPVAG00000013879   Transcript: ENSPVAT00000013880
Sequence length 609
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_2934:71806:78853:-1 gene:ENSPVAG00000013879 transcript:ENSPVAT00000013880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALLLLGSLLVSLESALLTPPRKAPMVHKHVGDKHTVVLTVTGEPCHFPFQYHRQLYHK
CTPKGQHGPRPWCATTPNFEQDQRWAYCLEPKKAQDHCSKHNPCQRGGTCVNMPRGPHCI
CPEHLTGKHCQREKCFEPQLFQFFHENETWLKLKPAGVAKCQCQGPQAHCKPLASQVCPT
NPCLNQGRCLEVDGHQLCSCPEGYAGRNCDVDIKASCYHGRGLSYRGTADTSFSGARCQP
WASEVTYRNLTAEQARSWGLGHHAFCRNPDNDTRPWCFVWSGDRLSWEYCLLSPCQAPTR
AAPQTPGAPRLPLPSLSALQKPQTTTQTPPQSPMLASRAMPEQRTPLPTKGPAGCGQRLR
KRLSSMSRISEGLVALPGAHPYIAALYWGHNFCAGSLIAPCWVLTAAHCLQNRPAPEELT
VVLGQDRHNQSCAQCQTLAVRTYHLHEAFSSITYQHDLALLRLQESADGNCVRLSPSVQP
VCLPSSAARPGESEAMVCEVAGWGHQFEGAEEYSTFLQEAQVPLISQERCSAPDVHGTAF
APGMLCAGFLEGGADACQXXXXXPLVCEDAAEHQLIRGIVSWGSGCDRNKPGVYTDVAYY
LTWMQEHTN
Download sequence
Identical sequences ENSPVAP00000013088 ENSPVAP00000013088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]