SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000013173 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000013173
Domain Number 1 Region: 10-97
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.11e-36
Family SCAN domain 0.0000115
Further Details:      
 
Domain Number 2 Region: 365-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000101
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 3 Region: 200-238
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000484
Family KRAB domain (Kruppel-associated box) 0.004
Further Details:      
 
Domain Number 4 Region: 299-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000285
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000013173   Gene: ENSPVAG00000013970   Transcript: ENSPVAT00000013969
Sequence length 421
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_453:64656:67800:1 gene:ENSPVAG00000013970 transcript:ENSPVAT00000013969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDPTATMEEAEASRLRFREFCYQQVAGPREALTQLRKLCRQWLRPEVHSKEQMLELLVLE
QFLGALPPEIQAWVQGRRPGSPEEAAALVEGLQRDPGQLLGWITAHVLKQVVLPAAQEIE
SLGSPHFSRIAEPLGEASGEGPHDARVEGSAQLSCSVKEEPDADAHDTAPSSPRNPAQPH
EGHLGHGKVDSKPCHPPRIQEEWGLLDPSQKELHWAAMLEKYGAGVSLGLPRPPSDPHGV
LEPRAPNEGTKSQGNLHPGGESKSRRKGPPGCPDGPPSWASPSGATASVASTPPGAAQSK
PYMCEQCGRGFDWKSVFVIHHRTHTGGQGARAPVLAVGGTKKPPQGPREPGALRHPRRVP
PGPRGYACEECGRSFSWKSQLVIHRKSHAGQRRHFCGNCGRGFDWKSQLVIHRKSHGPEA
S
Download sequence
Identical sequences ENSPVAP00000013173 ENSPVAP00000013173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]