SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000013179 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000013179
Domain Number 1 Region: 146-343
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.55e-57
Family Prokaryotic proteases 0.0000000189
Further Details:      
 
Domain Number 2 Region: 358-454
Classification Level Classification E-value
Superfamily PDZ domain-like 1.04e-23
Family HtrA-like serine proteases 0.000017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000013179   Gene: ENSPVAG00000013974   Transcript: ENSPVAT00000013975
Sequence length 457
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_4051:267277:270206:1 gene:ENSPVAG00000013974 transcript:ENSPVAT00000013975 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALRAGRGAGCSLWCVWRALGGIRWGKGPLLTPDLRVLLTSGTPDPRTRVTYGTPSLRVRL
SMGVPGSRTCLTSRTSDSRARLTAGTPDSRTQEDSGTPGARLRVWLAVALGVGGAVLLLL
WGGGRGPPAVFASVLGSPPSSPRSQYNFIADVVEKTAPAVVYIEILGRHPFSGREVPISN
GSGFVVAADGLIVTNAHVVADRRRVRVRLPSGDTYEAMVTAVDPVADIATLRIQTKEPLP
TLPLGRSSDVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQANVEYIQTDAAI
DFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSWFGISGSQRRY
IGVMMLTLTPSILAELQLREPSFPDVQHGVLIHKVILDSPAHRAGLRPGDVILAIGEQLV
QNAEDIYEAVRTQSQLAVRVRRGPETLTLYVTPEVTE
Download sequence
Identical sequences ENSPVAP00000013179 ENSPVAP00000013179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]