SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000013266 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000013266
Domain Number 1 Region: 4-45
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.0000000000813
Family Eukaryotic proteases 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000013266   Gene: ENSPVAG00000014069   Transcript: ENSPVAT00000014068
Sequence length 50
Comment pep:novel genescaffold:pteVam1:GeneScaffold_3940:29679:31121:-1 gene:ENSPVAG00000014069 transcript:ENSPVAT00000014068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVYLQSSPEPCVGTLIHPEWVLTAAHCPLPFQIRLGVYRPSIKHKSEQIR
Download sequence
Identical sequences ENSPVAP00000013266 ENSPVAP00000013266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]