SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000013282 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000013282
Domain Number 1 Region: 27-113
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.6e-29
Family SCAN domain 0.00012
Further Details:      
 
Domain Number 2 Region: 434-491
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.53e-22
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 3 Region: 476-528
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.91e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 4 Region: 398-448
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000124
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 5 Region: 213-253
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000641
Family KRAB domain (Kruppel-associated box) 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000013282   Gene: ENSPVAG00000014085   Transcript: ENSPVAT00000014085
Sequence length 539
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_2354:5362:23542:-1 gene:ENSPVAG00000014085 transcript:ENSPVAT00000014085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFDEQLLLPPSAKEDSYSGPDAAQEEPSSEIARQLFRQFRYVMSEPETRQLRKLCFQWL
QPEVHTKEQILEIVMLEQFLTILPGEIQMWVRKQCPGSGEEAVTLVESLKGDPQKLWQWI
SIQVLGQDILSEKVESASCQVGEVESHLEVMPQEPGLHNSPSVPEEPLSHIVKEESDTEQ
ELALAASHLPAQSEERLMREQDFGASLLQTAPQEQWRNLDSTQKEQYWDFMLETYGKMVS
GAGISSSKPDLTNSADYGEELTELHLHVSEKIPIPTCIGDRQENDKENLNLENYRGQGPS
DASCHASEEAPSQASLSGLFSEDGPKHFGEGEDPPEGQENLQDEGIGGQLSQERNSGKQL
GHHLPNPYPGELSMLWLEEKREASPKGQPRAPMAQKLPTCRECGKTFYRNSQLVFHQRTH
TGEAYFQCPTCKKAFLRSSDFVKHQRIHTGEKPCKCDYCGKGFSDFSGLRHHEKIHTGEK
PYKCPICEKSFIQRSNFNRHQRVHTGEKPYKCSCCGKSFSWSSSLDKHQRSHLGKKPFQ
Download sequence
Identical sequences ENSPVAP00000013282 ENSPVAP00000013282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]