SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000013417 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000013417
Domain Number 1 Region: 152-199
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.52e-16
Family LIM domain 0.0012
Further Details:      
 
Domain Number 2 Region: 31-79
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000105
Family LIM domain 0.00092
Further Details:      
 
Domain Number 3 Region: 112-151
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000804
Family LIM domain 0.0069
Further Details:      
 
Domain Number 4 Region: 3-30
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000022
Family LIM domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000013417   Gene: ENSPVAG00000014236   Transcript: ENSPVAT00000014236
Sequence length 208
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_3416:26555:31444:1 gene:ENSPVAG00000014236 transcript:ENSPVAT00000014236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKCPKCDKTVYFAEKVSSLGKDWHKFCLKCERCGKTLTPGGHAEHDGKPFCHKPCYAT
LFGPKGVNIGGAGSYIYEKPSAEGPQVTGPIEVPAARAEERKASGPPKGPSKASSVTTFT
GEPNMCPRCNKRVYFAEKVTSLGKDWHRPCLRCERCGKTLTPGGHAEHDGQPYCHKPCYG
ILFGPRGVNTGAVGSYIYNRDPEGKVQP
Download sequence
Identical sequences ENSPVAP00000013417 ENSPVAP00000013417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]