SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000013430 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000013430
Domain Number 1 Region: 232-422
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.19e-53
Family Eukaryotic proteases 0.000000102
Further Details:      
 
Domain Number 2 Region: 51-159
Classification Level Classification E-value
Superfamily Kringle-like 2.9e-32
Family Kringle modules 0.0000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000013430   Gene: ENSPVAG00000014248   Transcript: ENSPVAT00000014250
Sequence length 431
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_1250:6889:11476:1 gene:ENSPVAG00000014248 transcript:ENSPVAT00000014250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVLLVCLLLCALVVSNSKGSHDFHRVSGAKNCGCLNGGTCVSYKYFSNIQRCNCPKKFQ
GEHCEIDTSKTCYQGNGHSYRGKANTDFMGRPCLAWNSANVLLKTYHAQRPDALQLGLGK
HNYCRNPDNQRRPWCYVQVGFKQLVQECMVNDCSFGKKLFPPXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNYQKKEDYIVYL
GRSRLNSNTPGEMKFEVEKLILHEDYSADTLAHHNDIALLKISSNSGQCAQPSRSIQTIC
LLPKNDNARPGESCEITFGKENSTDYLYPEQLKMTVVKLVSHQDCQQPHYYGSEVTTQML
CAADPQWKTDSCQGDSGGPLVCSIHGRLTLTGIVSWGRGCAMKNKPGVYTRVSHFLTWIH
THFGEGNGLTL
Download sequence
Identical sequences ENSPVAP00000013430 ENSPVAP00000013430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]