SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000013440 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000013440
Domain Number 1 Region: 136-378
Classification Level Classification E-value
Superfamily vWA-like 9.45e-85
Family Integrin A (or I) domain 0.000000204
Further Details:      
 
Domain Number 2 Region: 635-723
Classification Level Classification E-value
Superfamily Integrin beta tail domain 6.54e-23
Family Integrin beta tail domain 0.00088
Further Details:      
 
Domain Number 3 Region: 355-461
Classification Level Classification E-value
Superfamily Integrin domains 0.0000000000000136
Family Integrin domains 0.0023
Further Details:      
 
Domain Number 4 Region: 24-81
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000011
Family Plexin repeat 0.0017
Further Details:      
 
Domain Number 5 Region: 592-633
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000206
Family Integrin beta EGF-like domains 0.0039
Further Details:      
 
Domain Number 6 Region: 551-589
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000837
Family Integrin beta EGF-like domains 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSPVAP00000013440
Domain Number - Region: 517-543
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0218
Family Integrin beta EGF-like domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000013440   Gene: ENSPVAG00000014260   Transcript: ENSPVAT00000014261
Sequence length 783
Comment pep:known_by_projection scaffold:pteVam1:scaffold_1428:170710:201335:1 gene:ENSPVAG00000014260 transcript:ENSPVAT00000014261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLQLIFWIGLISSICYVFGQADENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPT
SARCDDLEAKKGCHPDDIENPRGSKDIKKNKNVTTRSKGTAEKLQPEDIPQIQPQQLVLQ
LRSGEPQTFALKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDFRI
GFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTDKGEVFNELVGKQRIS
GNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQCH
LENDVYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSA
NSSNVIQLIIDAYNSLSSEVILENSKLPEGVTINYKSYCKNGVNGTGENGRKCSNISIGD
EVQFEISITSNKCPNKNSGTIKIRPLGFTEVEIILQFICECXXXXXXXXXXXXXXXXXXX
XXXXXXXCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRKRDN
TNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPDYTGSACDCSLDTTSCMATN
GQICNGRGICECGTCKCTDPKFQGPTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDTCAQ
ECSHFNITKVENRDKLPQPGQVDPLSHCKEKDVDDCWFYFTYSVNGNNEAIVHVVETPEC
PTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTVKILFI
KVP
Download sequence
Identical sequences ENSPVAP00000013440 ENSPVAP00000013440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]