SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000013596 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000013596
Domain Number 1 Region: 5-260
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.91e-85
Family Eukaryotic proteases 0.000000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000013596   Gene: ENSPVAG00000014427   Transcript: ENSPVAT00000014425
Sequence length 263
Comment pep:novel scaffold:pteVam1:scaffold_19910:1942:6429:1 gene:ENSPVAG00000014427 transcript:ENSPVAT00000014425 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTFLWFLSCFTLVGAAFGCGVPAIQPVLSGLSRIVNGEDAIPGSWPWQVSLQDSTGFHFC
GGSLISEDWVVTAAHCGVRTSHLVVAGEFDQGSDEENVQVLKIAKVFKNPKFNMLTVRND
ITLLKLATPARFSKTVSAVCLPDADDDFPAGSLCATTGWGRTKYNANKTPDKLQQAALPL
LSNAECKTFWGSKISDVMVCAGASGVSSCKGDSGGPLVCRKDESWTLVGIVSWGSSTCST
STPGVYARVTELIPWVQKILAAN
Download sequence
Identical sequences ENSPVAP00000013596 ENSPVAP00000013596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]