SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000013645 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000013645
Domain Number 1 Region: 23-142,319-629
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.7e-67
Family Integrin alpha N-terminal domain 0.0001
Further Details:      
 
Domain Number 2 Region: 162-341
Classification Level Classification E-value
Superfamily vWA-like 1.91e-40
Family Integrin A (or I) domain 0.00000801
Further Details:      
 
Domain Number 3 Region: 629-776
Classification Level Classification E-value
Superfamily Integrin domains 1.05e-24
Family Integrin domains 0.0017
Further Details:      
 
Domain Number 4 Region: 777-914
Classification Level Classification E-value
Superfamily Integrin domains 5.75e-21
Family Integrin domains 0.0049
Further Details:      
 
Domain Number 5 Region: 949-1076
Classification Level Classification E-value
Superfamily Integrin domains 0.0000000000241
Family Integrin domains 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000013645   Gene: ENSPVAG00000014476   Transcript: ENSPVAT00000014476
Sequence length 1151
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_2897:106488:120333:1 gene:ENSPVAG00000014476 transcript:ENSPVAT00000014476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELPLIPHLCWPLMFLTGLCSPFNLDVHHPRLFPGPPEAEFGYSVLQHVGGGRRWMLVGA
PWDGPSGDRRGDVYRCPVGGSHNAPCAKGHLGDYPLGNSSRPALNMHLGMSLLETDGDGG
FMACAPLWSRACGSSVFSSGICTRVDASFRPQGSLAPTAQRCPTYMDVVIVLDGSNSIYP
WSEVQTFLRRLVGRLFIDPEQIQVGLVQYGESPVHEWSLGDFRTKEEVVRAARNLSRRTE
GFSQSHGGRPEAARLLVVVTDGESHDGEELPAALKACEAGRVTRYGIAVLGHYIRRQRDP
SSFLREIRAIASDPDERFFFNVTDEAALTDIVDALGDRIFGLEGSRGENESSFGLEMSQI
GFSTHRLKDGILFGMVGAYDWGGSVLWLEEGHRLFPPRTALEDEFPPALQNHAAYLGYSV
SSMFLRGGRRLFLSRAPRFRHRGKVIXXXLKKDGAVRVAQSLQGEQIGSYFGSELCPLDT
DRDGTTDVLLVAAPMFLGPQNKETGRVYVYLVGQQPLLTFQGTLQPEPAQDARFGFAMGA
LPDLNQDGFADVAVGAPLEDGHRGALYLYHGTQNGVRPHPAQRIAAVSMPQALSYFGRSV
DGRLDLDGDDLVDVAVGAQGAAVLLSSQPIVHLAPSLDVTPPAISVVQRDCRRRGQEAAC
LSAALCFQVTSRTRGRWDRRFHLRFTASLDEWTAGARAAFDGSGQRLSPRRLRLSVGNVT
CEQLHFHVLDTSDYLRPVVLTVTFALDNTTKRGPVLDEGSPTSIRKLVPFSKDCGPDNEC
VTDLVLRADMDVRGSREDPFLVRGGRRKVLVSVILENRMENAYNTSLSLSFSRNLHLASF
TPQRDRPVKVECAAPAPHARLCSVGHPVFPTGAKVTFLLEFEFSCSSLLSRVLVRLTATS
NSLESSETLRDNTAEASAYVQYEPHLLFSSESTLHRYEVHPYGTLPVGPGPEFKTTLKVQ
NLGCYVVSGLIISAFLPAVAHGGNYFLSLSQVITNNASCTVQNLTEPPGHPVHPEDLQHT
SRLNGSNTRCQVVRCHLGWLAKGTEVSVGLLRLVHNEFFRKAKFKSVTVVSTFELGAEEG
SVLQLTEASRWSESLLEVIQTRPILISLWILIGSVLGGLLLLALLVFCLWKLGFFARKIP
EEEKREEKLEQ
Download sequence
Identical sequences ENSPVAP00000013645 ENSPVAP00000013645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]