SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000013760 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000013760
Domain Number 1 Region: 227-481
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.47e-65
Family Eukaryotic proteases 0.000000103
Further Details:      
 
Domain Number 2 Region: 44-161
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-23
Family Spermadhesin, CUB domain 0.00028
Further Details:      
 
Domain Number 3 Region: 191-235
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000302
Family Complement control module/SCR domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000013760   Gene: ENSPVAG00000014597   Transcript: ENSPVAT00000014597
Sequence length 485
Comment pep:known_by_projection scaffold:pteVam1:scaffold_3699:124000:131662:1 gene:ENSPVAG00000014597 transcript:ENSPVAT00000014597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGLRRGNLWGSPHSTSCPGKMWWLLLWGVLQACPTQGSVLLAQQLPQQLTSPGYPEPYL
KGQESTTVIEAPKGFAVRLVFQEFDLEPSQDCEQDSVTITASGMGPHRFCGQHGSPLGNL
PGQREFVSSGSSLQLTFCAPASSENKTTLLHKGFLALYQAVSINQSQPISQVSRGSETTR
TPGDNPFKTQNHCQEPYYQTMPTGMFTCTAQDPWKETQDREEVPHCAPVCGRPVIPIAQN
QEVQGSSKAKLGNFPWQAFTNIYGRGGGALLGDRWILTAAHTIYPKDSISLRKNRSVDVF
LGHTKTDELIKLGNHPVRRVVVHPDYHQNESHNFDGDIALLELQHSVPLGPRLLPVCLPN
SETLYRSGLMGYVSGFGVEKGWLTTELKYSKLPVAPREACKAWLQEKQRSEVFSDNMFCA
GNKTWQQSVCQGDSGGVYVVWDDRAHHWVATGIVSWGIGCGKGYGFYTKVLNYVDWIKGV
MDGKD
Download sequence
Identical sequences ENSPVAP00000013760 ENSPVAP00000013760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]