SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000013799 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000013799
Domain Number 1 Region: 50-131
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 7.78e-33
Family SCAN domain 0.0000675
Further Details:      
 
Domain Number 2 Region: 412-469
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.96e-26
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 3 Region: 468-525
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4e-26
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 512-570
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.52e-22
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 5 Region: 356-413
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.43e-21
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 6 Region: 318-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.49e-20
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 7 Region: 212-269
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000445
Family KRAB domain (Kruppel-associated box) 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000013799   Gene: ENSPVAG00000014639   Transcript: ENSPVAT00000014638
Sequence length 576
Comment pep:known_by_projection scaffold:pteVam1:scaffold_14359:19979:25114:1 gene:ENSPVAG00000014639 transcript:ENSPVAT00000014638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEPRRCLARSPADQTPEEDLVIVKVEEDHGWNQDSSLHEKRPPGQELFRRFRKLCYQE
TRGPREALIQLRALCHQWLRPDLHSKEQILELLVLEQFLAILPTELQVLVKEHQLEDGEE
VVTLLEDVERQIDILGRPVPAGALGHRVLWEERLPSEPAPEPADAQPQPVAAQHTPTVLP
GPRESAGSASQSPTASQKGSPGDQVTATLLTAGFQTLEKIEDMAVSLIREEWLLDSSQKD
LSGDNRPENYRSTFSLGGETRNENRELASKQVIPAGVHPHGETAAKCNGDAIGGLEHGEA
RDLLGRLERQRGNPTQERRHKCDECGKSFAQSSGLVRHWRIHTGEKPYQCNVCGKAFSYR
SALLSHQDIHNKVKRYHCKECGKAFSQNTGLILHQRIHTGEKPYQCSQCGKAFSQSAGLI
LHQRIHSGERPYECNECGKAFSHSSHLIGHQRIHTGEKPYECDECGKTFRRSSHLIGHQR
SHTGEKPYKCNECGRAFSQKSGLIEHQRIHTGERPYKCKECGKAFNGNTGLIQHLRIHTG
EKPYQCSECGKAFIQRSSLIRHQRIHSGEKSESIGV
Download sequence
Identical sequences ENSPVAP00000013799 ENSPVAP00000013799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]