SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000013925 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000013925
Domain Number 1 Region: 432-693
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.32e-78
Family Eukaryotic proteases 0.0000000331
Further Details:      
 
Domain Number 2 Region: 34-144
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.24e-31
Family Spermadhesin, CUB domain 0.00000117
Further Details:      
 
Domain Number 3 Region: 192-303
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.11e-28
Family Spermadhesin, CUB domain 0.00000151
Further Details:      
 
Domain Number 4 Region: 374-444
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.31e-16
Family Complement control module/SCR domain 0.0000139
Further Details:      
 
Domain Number 5 Region: 308-377
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000208
Family Complement control module/SCR domain 0.0000796
Further Details:      
 
Domain Number 6 Region: 143-189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000958
Family EGF-type module 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000013925   Gene: ENSPVAG00000014774   Transcript: ENSPVAT00000014774
Sequence length 694
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_1209:35432:47985:-1 gene:ENSPVAG00000014774 transcript:ENSPVAT00000014774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGQRDGHTMRLLVLLGLLCGSVAAPTGPQWPKPVFGRLASPGFPGKYANNQEQRWTLTAP
PGYRLRLYFTHFHLELSYLCEYDFVKLSSGSKVLATLCGRQSTDTERAPGNDTFYSPGPS
LDVTFHSDYSNEGPFTGFEAFYAAEDIDECQVPPDEAPTCDHYCHNYLGSFYCSCRAGYV
LHQDKRTCSALCSGQVFADRSGVISSPEYPRPYPRLSSCTYSIHLEEGFAIILDFVESFD
VEMHPEIQCPYDLLKIQTDKKEYGPFCGKTLPGRIETQSNSVTITFVTDQSGDHTGWKVH
YTSTALPCPDPVAPPNGRISPVQAKYILKDSFSVFCETGYELLQGYLPLKSFAAVCQKDG
SWDQPMPECSIVDCGPPDDLPNGQVEYITGPEVTTYEAVIQYRCNEPFYTMRTDDGKYVC
EADGFWTSSKGEKSLPVCEPVCGLSTRKTEGRIYGGQNAKLGDFPWQVLLLRGDTTAAGA
LLHDGWILTAAHAIYGQKDASSLDIRMGFLKRLSPHYTQAWAEAIFIHEDYTHDAGFDND
IALIKLKNRVAINSNVMPICLPRKEAESFMRTNDIGTASGWGLTQRGFLARSLMFVDIPI
VDHQKCTAAYETKPYQGGQVTDNMICAGLESGGKDSCRGDSGGALVFLDNETRRWFVGGI
VSWGSINCGEAHQYGVYTKVMNYIPWIKKIINNF
Download sequence
Identical sequences ENSPVAP00000013925 ENSPVAP00000013925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]