SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000013932 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000013932
Domain Number 1 Region: 14-255
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.44e-62
Family Eukaryotic proteases 0.000000149
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000013932   Gene: ENSPVAG00000014782   Transcript: ENSPVAT00000014781
Sequence length 257
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_196:172236:185487:-1 gene:ENSPVAG00000014782 transcript:ENSPVAT00000014781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRFRHSTEDFPETNARVVGGTEAKKNSWPSQISLQYLSNNNWYHTCGGTLVKKNWVMTA
AHCVDSKLTFRVVVGDHNLSQNDGTEQYVKVQKIVVHPSWNSNNVAAGYDIALLRLAQSV
TLNSYVALGVLPKEGTILANNSPCYITGWGRTRXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXGDSGGPLHCLVNGKYAVHGVTSFVSSQGCNVSKKPTVF
TRVSAYISWINNVIAKN
Download sequence
Identical sequences ENSPVAP00000013932 ENSPVAP00000013932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]