SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000013960 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000013960
Domain Number 1 Region: 299-562
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.6e-86
Family Eukaryotic proteases 0.00000000291
Further Details:      
 
Domain Number 2 Region: 105-211
Classification Level Classification E-value
Superfamily Kringle-like 9.42e-33
Family Kringle modules 0.00026
Further Details:      
 
Domain Number 3 Region: 214-301
Classification Level Classification E-value
Superfamily Kringle-like 5.56e-31
Family Kringle modules 0.0000242
Further Details:      
 
Domain Number 4 Region: 36-84
Classification Level Classification E-value
Superfamily FnI-like domain 2.93e-19
Family Fibronectin type I module 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000013960   Gene: ENSPVAG00000014812   Transcript: ENSPVAT00000014811
Sequence length 563
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_448:177491:187416:-1 gene:ENSPVAG00000014812 transcript:ENSPVAT00000014811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKTKRELLCILLLCGAVFTLPSQETHRRLRRGGRSYRVICRDEKTQMTYRQHESWLRPV
LRSNRVEYCWCNSGQSQCHSVPVKGCNEPRCFNGGTCRQALYFSDFVCQCPEGFSGKLCE
IDASATCYKDQGVTYRGMWSTAKSGAECVNWNSSVLARKPYNGQRSDAIRLGLGNHNYCR
NPDEDSKPWCYVFKAGKYSSESCSVPACSKEKNEDCYFGKGLAYRGTYSLTTSGASCLQW
NSMILLGKVYTAWKTNAKTLGLGKHNYCRNPDGDAKPWCHVLKDLKLTWEYCDIPQCSTC
GLRQYKRPQFRIKGGLFSDITSHPWQAAIFVQNRRSPGERFLCGGTLISSCWVLSAAHCF
LERFPPHHIKVVLGRTYQAVPGEEEQIFEVEKYIVHKEFDDDTYNNDIALLQLKSDSLQC
AQESDTVRTVCLPEADLQLPDWTECELSGYGKHEASSPFYSHRLKEAHVRLYPSSRCTSQ
HLFNKTITNNMLCAGDTRSGGNQANLHDACQGDSGGPLVCESDRHMTLVGIISWGIGCGQ
KDVPGVYTKVANYLGWIQDTTRA
Download sequence
Identical sequences ENSPVAP00000013960 ENSPVAP00000013960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]