SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000014385 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000014385
Domain Number 1 Region: 201-442
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.26e-82
Family Eukaryotic proteases 0.00022
Further Details:      
 
Domain Number 2 Region: 54-179
Classification Level Classification E-value
Superfamily SEA domain 1.07e-26
Family SEA domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000014385   Gene: ENSPVAG00000015261   Transcript: ENSPVAT00000015261
Sequence length 443
Comment pep:known_by_projection scaffold:pteVam1:scaffold_5893:25967:61116:-1 gene:ENSPVAG00000015261 transcript:ENSPVAT00000015261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILLLGICHQPVEFSEADYPQVEYQRRQQFWDPIRLALFTLAIVVIIGIAIGIVTHFVVED
DKSFYYIASFQVTNIKYKENYGMRTSREFTQRSHQIERMMSRIFQRSSGAGRFIKSHVIQ
ISPDENGVNILVVLMFRYPSTGSAERIRTKIENILYQSLKTKQLPLTIDKPSLTLTSIDS
KKMRNLLNSRCGIRMTSSNMPLPASTSTERIVQGRETAMEGEWPWQASLQLRDAGHQCGA
SLISNTWLLTAAHCFRKNKDPSQWIATFGTTIAPPAVQRNVGKIILHENYRRETNENDIA
LAQLTTRVEFSNVVQRVCLPDASIKLTPKTSVFVTGFGSIVDDGPTQNKLRQARVETIST
DVCNRKDVYDGLITSGMLCAGFMEGKVDACKGDSGGPLVYDNHDIWYLVGIVSWGQSCAL
PKKPGVYTRVTQYRDWIASKTGI
Download sequence
Identical sequences ENSPVAP00000014385 ENSPVAP00000014385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]