SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000014663 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000014663
Domain Number 1 Region: 173-421
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.02e-81
Family Eukaryotic proteases 0.0000488
Further Details:      
 
Domain Number 2 Region: 41-165
Classification Level Classification E-value
Superfamily SEA domain 0.000000000000876
Family SEA domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000014663   Gene: ENSPVAG00000015552   Transcript: ENSPVAT00000015552
Sequence length 422
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_454:150679:198359:1 gene:ENSPVAG00000015552 transcript:ENSPVAT00000015552 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYSSSVMRARRRNCLKPWILGLITFVFLIVLAVCIGLIVHYVRYNQRKTYNYYSTLSFSS
DELYGDFGREASKNFTEMSQKIESMVKNAFYKSPLREEFVKSHIIRFSKEENGVLAHMLL
IFRFRSTEDPETINKNIQRVLHEKLQDAVGPPNLYPESIEIKKINKTETDNFLNSCCGTR
RNQTTKQSLRIVGGTQVEEGEWPWQASLQWDGIHRCGATLINCTWLVSAAHCFRVYKDPA
GWTASFGVTINPPKMKRGIRRIIVHEKYKYPSHDYDISVAELSSPVPYTNAVHRICLPDA
SYEFHPGDEMFVTGFGARQNDGNSQNHLRQVQVNLIDTKTCNEPQVYNNALTPRMLCAGS
LQGKRDACQGDSGGPLVSPDARDIWYLAGIVSWGDECGQPNKPGVYTRVTAFRDWITSQT
GI
Download sequence
Identical sequences ENSPVAP00000014663 ENSPVAP00000014663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]